DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rt and Sdf2l1

DIOPT Version :9

Sequence 1:NP_524025.2 Gene:rt / 39297 FlyBaseID:FBgn0003292 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_001102903.1 Gene:Sdf2l1 / 680945 RGDID:1585844 Length:220 Species:Rattus norvegicus


Alignment Length:197 Identity:56/197 - (28%)
Similarity:83/197 - (42%) Gaps:47/197 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 GGLASITKGQPLAVVHGSQITLRHTHGRTCWLHSHAAVYPVRYPDKRGS-SHQQQVT-CYSFKDV 502
            ||.:..:.|   .|..||.:.|.:||.|. .||||...|        || |.||.|| ..:..|.
  Rat    25 GGASKASAG---LVTCGSVLKLLNTHHRV-RLHSHDIKY--------GSGSGQQSVTGVEASDDA 77

  Fly   503 NNWWLVKRPTKENLVVGDEPDIIRHGEIIQLVHGITSRALNSHDVAAAMTPQCQEVSCYIDYEIK 567
            |::|.::..::.....|..   :|.|:.::|.|.:|.:.|::|...:.::.. ||||.:      
  Rat    78 NSYWRIRGGSEGGCPRGLP---VRCGQAVRLTHVLTGKNLHTHHFPSPLSNN-QEVSAF------ 132

  Fly   568 MAGELLWRVEILNRDSEG---DIWHA--------IKSEVRLVHVSTEASLKFSGRQLPEWGFNQH 621
              ||          |.||   |:|..        .::.||..||.|...|..:|.|.......||
  Rat   133 --GE----------DGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQH 185

  Fly   622 EV 623
            ||
  Rat   186 EV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtNP_524025.2 PMT 178..421 CDD:280519
PMT1 180..877 CDD:224839 56/197 (28%)
MIR 452..508 CDD:197746 22/57 (39%)
MIR 522..578 CDD:197746 13/55 (24%)
MIR 586..642 CDD:197746 14/46 (30%)
PMT_4TMC 672..875 CDD:292810
Sdf2l1NP_001102903.1 PMT1 <52..>199 CDD:224839 46/166 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.