Sequence 1: | NP_524025.2 | Gene: | rt / 39297 | FlyBaseID: | FBgn0003292 | Length: | 886 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102903.1 | Gene: | Sdf2l1 / 680945 | RGDID: | 1585844 | Length: | 220 | Species: | Rattus norvegicus |
Alignment Length: | 197 | Identity: | 56/197 - (28%) |
---|---|---|---|
Similarity: | 83/197 - (42%) | Gaps: | 47/197 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 440 GGLASITKGQPLAVVHGSQITLRHTHGRTCWLHSHAAVYPVRYPDKRGS-SHQQQVT-CYSFKDV 502
Fly 503 NNWWLVKRPTKENLVVGDEPDIIRHGEIIQLVHGITSRALNSHDVAAAMTPQCQEVSCYIDYEIK 567
Fly 568 MAGELLWRVEILNRDSEG---DIWHA--------IKSEVRLVHVSTEASLKFSGRQLPEWGFNQH 621
Fly 622 EV 623 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rt | NP_524025.2 | PMT | 178..421 | CDD:280519 | |
PMT1 | 180..877 | CDD:224839 | 56/197 (28%) | ||
MIR | 452..508 | CDD:197746 | 22/57 (39%) | ||
MIR | 522..578 | CDD:197746 | 13/55 (24%) | ||
MIR | 586..642 | CDD:197746 | 14/46 (30%) | ||
PMT_4TMC | 672..875 | CDD:292810 | |||
Sdf2l1 | NP_001102903.1 | PMT1 | <52..>199 | CDD:224839 | 46/166 (28%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1928 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |