DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rt and SDF2

DIOPT Version :9

Sequence 1:NP_524025.2 Gene:rt / 39297 FlyBaseID:FBgn0003292 Length:886 Species:Drosophila melanogaster
Sequence 2:XP_011523408.1 Gene:SDF2 / 6388 HGNCID:10675 Length:230 Species:Homo sapiens


Alignment Length:190 Identity:58/190 - (30%)
Similarity:83/190 - (43%) Gaps:32/190 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 GGLASITKGQPLAVVH-GSQITLRHTHGRTCWLHSHAAVYPVRYPDKRGS-SHQQQVT-CYSFKD 501
            |||.|......|.||. ||.:.|.:|. ....||||    .|||    || |.||.|| ..|..|
Human    10 GGLWSAVGASSLGVVTCGSVVKLLNTR-HNVRLHSH----DVRY----GSGSGQQSVTGVTSVDD 65

  Fly   502 VNNWWLVKRPTKENLVVGDEPDIIRHGEIIQLVHGITSRALNSHDVAAAMT---PQCQEVSCYID 563
            .|::|.::   .::..|.:....|:.|:.|:|.|..|.|.|:||...:.::   .:.|.:..:.:
Human    66 SNSYWRIR---GKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQRRKQRLKGFTE 127

  Fly   564 YEIKMAGELLWRVEILNRDSEGDI---WHAI--------KSEVRLVHVSTEASLKFSGRQ 612
            ..||:..:   .|.....:.|||.   |..:        ..|||..|.|||..|..:|.|
Human   128 EGIKLRFK---EVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtNP_524025.2 PMT 178..421 CDD:280519
PMT1 180..877 CDD:224839 58/190 (31%)
MIR 452..508 CDD:197746 24/58 (41%)
MIR 522..578 CDD:197746 14/58 (24%)
MIR 586..642 CDD:197746 12/38 (32%)
PMT_4TMC 672..875 CDD:292810
SDF2XP_011523408.1 MIR 22..72 CDD:197746 24/58 (41%)
MIR 83..157 CDD:197746 18/76 (24%)
MIR 159..208 CDD:197746 10/26 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.