DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rt and sdf2

DIOPT Version :9

Sequence 1:NP_524025.2 Gene:rt / 39297 FlyBaseID:FBgn0003292 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_001016483.1 Gene:sdf2 / 549237 XenbaseID:XB-GENE-489307 Length:218 Species:Xenopus tropicalis


Alignment Length:224 Identity:61/224 - (27%)
Similarity:93/224 - (41%) Gaps:66/224 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 SLDGGLASITKGQPLAVVHGSQITLRHTHGRTCWLHSHAAVYPVRYPDKRGS-SHQQQVT-CYSF 499
            |:...|:.:|.|..:.:     :.::|    :..||||    .|||    || |.||.|| ..|.
 Frog    23 SIASELSVVTCGSVVKL-----LNIKH----SVRLHSH----DVRY----GSGSGQQSVTGVTSV 70

  Fly   500 KDVNNWWLVKRPTKENLVVGDEPDIIRHGEIIQLVHGITSRALNSHDVAAAMTPQCQEVSCYIDY 564
            .|.|::|.::..|.   .|.:...:|:.|:.::|.|..|.|.|:||...:.::.. ||||.:.| 
 Frog    71 DDGNSYWRIRGQTS---TVCERGKLIKCGQSVRLTHVNTGRNLHSHHFTSPLSGN-QEVSAFGD- 130

  Fly   565 EIKMAGELLWRVEILNRDSEGDI---WHAI--------KSEVRLVHVSTEASLKFSGRQLPEWGF 618
                             |.||||   |..:        ..|||..|.||...|..:|.|   :| 
 Frog   131 -----------------DGEGDILDDWTVLCGGEFWQRDDEVRFRHTSTSVFLSVTGEQ---YG- 174

  Fly   619 NQHEVVADREKAIH------EDAIWNVEE 641
              ..:...||  :|      :::.|.|.|
 Frog   175 --RPINGQRE--VHGMSYANQNSYWKVME 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtNP_524025.2 PMT 178..421 CDD:280519
PMT1 180..877 CDD:224839 61/224 (27%)
MIR 452..508 CDD:197746 19/57 (33%)
MIR 522..578 CDD:197746 14/55 (25%)
MIR 586..642 CDD:197746 19/73 (26%)
PMT_4TMC 672..875 CDD:292810
sdf2NP_001016483.1 MIR 30..79 CDD:197746 21/65 (32%)
MIR 39..183 CDD:280906 53/190 (28%)
MIR 90..144 CDD:197746 20/72 (28%)
MIR 146..199 CDD:197746 15/60 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.