| Sequence 1: | NP_524025.2 | Gene: | rt / 39297 | FlyBaseID: | FBgn0003292 | Length: | 886 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001003730.2 | Gene: | sdf2l1 / 445275 | ZFINID: | ZDB-GENE-040808-46 | Length: | 218 | Species: | Danio rerio |
| Alignment Length: | 219 | Identity: | 60/219 - (27%) |
|---|---|---|---|
| Similarity: | 86/219 - (39%) | Gaps: | 70/219 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 453 VVHGSQITLRHTHGRTCWLHSHAAVYPVRYPDKRGS-SHQQQVT-CYSFKDVNNWWLVKRPTKEN 515
Fly 516 LVVGDEPDI------IRHGEIIQLVHGITSRALNSHDVAAAMTPQCQEVSCYIDYEIKMAGELLW 574
Fly 575 RVEILNRDSEG---DIWHA--------IKSEVRLVHVSTEASLKFSGRQLPEWGFNQHEVVADRE 628
Fly 629 KAIH------EDAIWNVEEHRYTQ 646 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| rt | NP_524025.2 | PMT | 178..421 | CDD:280519 | |
| PMT1 | 180..877 | CDD:224839 | 60/219 (27%) | ||
| MIR | 452..508 | CDD:197746 | 21/56 (38%) | ||
| MIR | 522..578 | CDD:197746 | 17/61 (28%) | ||
| MIR | 586..642 | CDD:197746 | 17/69 (25%) | ||
| PMT_4TMC | 672..875 | CDD:292810 | |||
| sdf2l1 | NP_001003730.2 | MIR | 33..82 | CDD:197746 | 21/56 (38%) |
| MIR | 93..148 | CDD:197746 | 20/73 (27%) | ||
| MIR | 156..202 | CDD:197746 | 15/53 (28%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG1928 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||