DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rt and sdf2

DIOPT Version :9

Sequence 1:NP_524025.2 Gene:rt / 39297 FlyBaseID:FBgn0003292 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_956333.1 Gene:sdf2 / 336879 ZFINID:ZDB-GENE-030131-8823 Length:222 Species:Danio rerio


Alignment Length:234 Identity:66/234 - (28%)
Similarity:102/234 - (43%) Gaps:36/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 PHDSIMTSAFQASLDGGLASITKGQPLAVVHGSQITLRHTHGRTCWLHSHAAVYPVRYPDKRGS- 488
            |...:::..|..:|...:..:|.|..:.:     |.::|    ...||||    .|||    || 
Zfish    12 PLTVLLSCVFTLTLCSEMNCVTCGSVVKL-----INVKH----NVRLHSH----DVRY----GSG 59

  Fly   489 SHQQQVT-CYSFKDVNNWWLVKRPTKENLVVGDEPDIIRHGEIIQLVHGITSRALNSHDVAAAMT 552
            |.||.|| ..:.:|.|::|.| |.|.::......|  :|.|:.|:|.|..|.|.|:||...:.::
Zfish    60 SGQQSVTGVTTVEDSNSYWSV-RGTSDHSCHRGTP--VRCGQNIRLTHVNTGRNLHSHYFTSPLS 121

  Fly   553 PQCQEVSCYIDYEIKMAGELL--WRVEILNRDSEGDIWHAIKSEVRLVHVSTEASLKFSGRQLPE 615
            .. ||||.:.:   ...|:.|  |.|..:     |.||...:| ||..|.:|||.|..:|.|...
Zfish   122 SN-QEVSAFGE---NGEGDHLDEWTVLCV-----GSIWQRDES-VRFQHTATEALLSVTGEQFGR 176

  Fly   616 WGFNQHEVVADREKAIHEDAIWNVEEHRYTQTEDHRERE 654
            ....|.||......:.|  :.|...|..:.:..:...|:
Zfish   177 PIHGQREVHGMMVSSSH--SYWRTMEGIFIKPSEAGSRD 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtNP_524025.2 PMT 178..421 CDD:280519
PMT1 180..877 CDD:224839 66/234 (28%)
MIR 452..508 CDD:197746 19/57 (33%)
MIR 522..578 CDD:197746 19/57 (33%)
MIR 586..642 CDD:197746 17/55 (31%)
PMT_4TMC 672..875 CDD:292810
sdf2NP_956333.1 MIR 32..80 CDD:197746 21/64 (33%)
MIR 91..146 CDD:197746 19/60 (32%)
MIR 155..200 CDD:197746 15/47 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.