DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rt and R12E2.13

DIOPT Version :9

Sequence 1:NP_524025.2 Gene:rt / 39297 FlyBaseID:FBgn0003292 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_491320.1 Gene:R12E2.13 / 172010 WormBaseID:WBGene00020038 Length:206 Species:Caenorhabditis elegans


Alignment Length:187 Identity:59/187 - (31%)
Similarity:83/187 - (44%) Gaps:27/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 LHSHAAVYPVRYPDKRGS-SHQQQVTCY-SFKDVNNWWLVKRPTKENLVVGDEPDIIRHGEIIQL 533
            ||||...|        || |.||.||.. :..|:|:.|.:..........|   |.|:.|:.|:|
 Worm    43 LHSHDVKY--------GSGSGQQSVTAVKNSDDINSHWQIFPALNAKCNRG---DAIKCGDKIRL 96

  Fly   534 VHGITSRALNSHDVAAAMTPQCQEVSCYIDYEIKMAGELLWRVEILNRDSEGDIWHAIKSE-VRL 597
            .|..|...|:||...|.::.|.||||.:........|: .|.| |.|    ||.|  ::|| .:|
 Worm    97 KHLTTGTFLHSHHFTAPLSKQHQEVSAFGSEAESDTGD-DWTV-ICN----GDEW--LESEQFKL 153

  Fly   598 VHVSTEASLKFSGRQLPEWGFNQHEVVADREKAIHEDAIWNVEEHRYTQTEDHRERE 654
            .|..|.:.|..||:|.......|.|||.  ..:|...:.|.|.|..|.:   |::::
 Worm   154 RHAVTGSYLSLSGQQFGRPIHGQREVVG--TDSITGGSAWKVAEGIYIK---HQQKD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtNP_524025.2 PMT 178..421 CDD:280519
PMT1 180..877 CDD:224839 59/187 (32%)
MIR 452..508 CDD:197746 15/38 (39%)
MIR 522..578 CDD:197746 19/55 (35%)
MIR 586..642 CDD:197746 18/56 (32%)
PMT_4TMC 672..875 CDD:292810
R12E2.13NP_491320.1 MIR 23..77 CDD:197746 15/41 (37%)
MIR 34..180 CDD:280906 51/155 (33%)
MIR 85..141 CDD:197746 21/60 (35%)
MIR 143..195 CDD:197746 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.