DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and MOB2

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_116618.1 Gene:MOB2 / 850508 SGDID:S000001859 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:369 Identity:86/369 - (23%)
Similarity:141/369 - (38%) Gaps:103/369 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SSYNFAAALRRNKKPKQQQQQLATSTDDDDSCRSINSINSNCSNSSTSGSSHSLSNSCINNHNNT 186
            |.:||.|..|.:||.|.|...:|...       ::|:|.|         |.|| |||.::..|..
Yeast     2 SFFNFKAFGRNSKKNKNQPLNVAQPP-------AMNTIYS---------SPHS-SNSRLSLRNKH 49

  Fly   187 HYRNSKNTRHSSSNNNDYSGNYNCKTSEQQAWKASAAQQLLISDRNYPSSNTNNTNNNTNNITNS 251
            |    ...|||.:                                ::|:..:             
Yeast    50 H----SPKRHSQT--------------------------------SFPAQKS------------- 65

  Fly   252 SNNNHSGGHIIMSPTSQAPTRTSLFDSCHRKIRLIGGGPVAFLGGLVAKARRKERDGDQNSTDTK 316
                        :|.||..|.|:                         ...:::...:::.:...
Yeast    66 ------------TPQSQQLTSTT-------------------------PQSQQQEASERSESQQI 93

  Fly   317 LYLEESVLERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTG 381
            ::|.|..:...|.:...|.:|.||..:|..||:|.:....|.::|..||.::|:.|......|..
Yeast    94 MFLSEPFVRTALVKGSFKTIVQLPKYVDLGEWIALNVFEFFTNLNQFYGVVAEYVTPDAYPTMNA 158

  Fly   382 PGNRTYLWFDEKGKKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKILRLQF 446
            ..:..|||.|...::..:.|.||||..:|:....|:|:::||||....||..|....::|:...|
Yeast   159 GPHTDYLWLDANNRQVSLPASQYIDLALTWINNKVNDKNLFPTKNGLPFPQQFSRDVQRIMVQMF 223

  Fly   447 HVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKE 490
            .:.||:|..||.:|..|.|..|.|..|:|..:..:.|.:||.||
Yeast   224 RIFAHIYHHHFDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 54/163 (33%)
MOB2NP_116618.1 Mob1_phocein 102..271 CDD:397617 54/166 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.