DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and MOB1-like

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_199368.1 Gene:MOB1-like / 834591 AraportID:AT5G45550 Length:215 Species:Arabidopsis thaliana


Alignment Length:200 Identity:71/200 - (35%)
Similarity:107/200 - (53%) Gaps:5/200 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 KARRKERDGDQNSTDTKLYLEESVLERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVY 364
            |..|.::.....|...:|   ...::..|...:|:..|.||.|.|.|||||.:|:..|..|||:|
plant    11 KTFRPKKSAPSGSKGAQL---RKHIDATLGSGNLREAVRLPPGEDANEWLAVNTVDFFNQVNLLY 72

  Fly   365 GTISEFCTQSGCADMTGPGNRTYLWFD--EKGKKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYA 427
            ||::||||...|..||......|.|.|  :..|...|:||:|::|:|.:.:..:.||::||.:..
plant    73 GTLTEFCTPDNCPTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMDWIETQLDDETLFPQRLG 137

  Fly   428 NEFPGSFESIARKILRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETD 492
            ..||.:|:.:.:.|.:..|.|.||:|.:||::|..|....|||..|.|.......|.|||:||..
plant   138 APFPQNFKDVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFILFTHEFGLIDKKELA 202

  Fly   493 VLRDL 497
            .|::|
plant   203 PLQEL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 65/167 (39%)
MOB1-likeNP_199368.1 Mob1_phocein 33..204 CDD:397617 65/170 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22599
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.