DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and AT5G20440

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_197544.3 Gene:AT5G20440 / 832166 AraportID:AT5G20440 Length:216 Species:Arabidopsis thaliana


Alignment Length:190 Identity:69/190 - (36%)
Similarity:99/190 - (52%) Gaps:18/190 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 ERKLPE--------------ADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSG 375
            :||.||              .:|:..|.||.|:|.|||.|.:|:..|..::|:|.|:.|||||:.
plant    21 KRKHPEYKSKIRELISGIRSDNLREAVRLPQGVDINEWFAMNTVDFFNQISLLYATLEEFCTQTT 85

  Fly   376 CADMTGPGNRTYLWFDEK--GKKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIA 438
            |..|.. |...|.|.|..  .|...|:||:|::|::.:.:..:.:|:|||......||.:||...
plant    86 CPVMNA-GRYEYRWADGTTITKPKTVSAPKYVEYLIDWVETEIDNEAIFPKNPGEPFPPNFEDFV 149

  Fly   439 RKILRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLID-EKETDVLRDL 497
            ::|||..|.|.||:|.:||.||..|....|||..|.|.......|.|:| |||...::.|
plant   150 KRILRKLFRVYAHIYYSHFHEIVALNEQAHLNTCFKHFLLFVSEFQLVDKEKEMAPIKSL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 66/182 (36%)
AT5G20440NP_197544.3 Mob1_phocein 38..205 CDD:281617 64/167 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22599
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.