DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and AT5G20430

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_197543.1 Gene:AT5G20430 / 832165 AraportID:AT5G20430 Length:122 Species:Arabidopsis thaliana


Alignment Length:108 Identity:39/108 - (36%)
Similarity:57/108 - (52%) Gaps:3/108 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 GNRTYLWFDEKGKKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKILRLQFH 447
            |...|.|.|   ..|.|:||:|::.:|.:.:..:.:|.|||.|....||.:||...::|||..|.
plant     4 GRYEYRWAD---GTTMVSAPEYVELLMNWIETQIDNEHIFPKKTGEPFPPNFEDFVKRILRKLFR 65

  Fly   448 VIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKE 490
            |.||:|.:||.:|..|....|||..|.........|.|:|::|
plant    66 VYAHIYHSHFPKIVTLNEQAHLNTCFHRYLLFVSEFQLVDKEE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 39/108 (36%)
AT5G20430NP_197543.1 Mob1_phocein <1..111 CDD:281617 39/108 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22599
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.