DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and AT4G19045

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001154253.1 Gene:AT4G19045 / 7922308 AraportID:AT4G19045 Length:215 Species:Arabidopsis thaliana


Alignment Length:176 Identity:68/176 - (38%)
Similarity:101/176 - (57%) Gaps:2/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 LERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPGNRTYL 388
            ::..|...:|:..|.||.|.|.|||||.:|:..|..|||::||::||||...|:.||......|.
plant    32 IDATLGSGNLREAVKLPPGEDLNEWLAVNTVDFFNQVNLLFGTLTEFCTPENCSTMTAGPKYEYR 96

  Fly   389 WFD--EKGKKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKILRLQFHVIAH 451
            |.|  :..|...|:||:|::|:|.:.:..:.||:|||.|....||.:|:.:.:.|.:..|.|.||
plant    97 WADGVQIKKPIEVSAPKYVEYLMDWIETQLDDETIFPQKLGAAFPPNFKEVVKTIFKRLFRVYAH 161

  Fly   452 LYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETDVLRDL 497
            :|.:||::|..|....|||..|.|.......|.|||:||...|::|
plant   162 IYHSHFQKIVSLKEEAHLNTCFKHFILFTHEFVLIDKKELAPLQEL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 66/167 (40%)
AT4G19045NP_001154253.1 Mob1_phocein 33..204 CDD:397617 66/170 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22599
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.