DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and Mob1b

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_081011.1 Gene:Mob1b / 68473 MGIID:1915723 Length:216 Species:Mus musculus


Alignment Length:175 Identity:70/175 - (40%)
Similarity:102/175 - (58%) Gaps:2/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 ERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPGNRTYLW 389
            |..|...:|:..|.||.|.|.|||:|.:|:..|..:|::||||::|||:..|..|:......|.|
Mouse    33 EATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHW 97

  Fly   390 FDEKG--KKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKILRLQFHVIAHL 452
            .|...  |..:.:||:||||:||:.|..:.||::||:|....||.:|.|:|:.||:..|.|.||:
Mouse    98 ADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHI 162

  Fly   453 YAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETDVLRDL 497
            |..||..:..|....|||.:|.|.....:.|||||.:|...|::|
Mouse   163 YHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQEL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 67/167 (40%)
Mob1bNP_081011.1 Mob1_phocein 33..204 CDD:397617 68/170 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.