DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and mob1a

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_017947592.1 Gene:mob1a / 549780 XenbaseID:XB-GENE-950160 Length:275 Species:Xenopus tropicalis


Alignment Length:175 Identity:72/175 - (41%)
Similarity:104/175 - (59%) Gaps:2/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 ERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPGNRTYLW 389
            |..|...:|:..|.||.|.|.|||:|.:|:..|..:|::||||:||||:|.|:.|:......|.|
 Frog    92 EATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTESTCSVMSAGPRYEYHW 156

  Fly   390 FDEKG--KKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKILRLQFHVIAHL 452
            .|...  |..:.:||:||||:||:.|..:.||::||:|....||.:|.|:|:.||:..|.|.||:
 Frog   157 ADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHI 221

  Fly   453 YAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETDVLRDL 497
            |..||..:..|....|||.:|.|.....:.|||||.:|...|::|
 Frog   222 YHQHFDAVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQEL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 69/167 (41%)
mob1aXP_017947592.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.