DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and mob2.2

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001008166.1 Gene:mob2.2 / 493528 XenbaseID:XB-GENE-5751803 Length:234 Species:Xenopus tropicalis


Alignment Length:220 Identity:87/220 - (39%)
Similarity:122/220 - (55%) Gaps:7/220 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 KARRKERDGDQNSTDTKLYLEESVLERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVY 364
            |:..|::...:.....|:|||......::.:||:..||.||.||:..|||||:..|.:.||:|.|
 Frog    17 KSINKDKREKKGIEPEKIYLEPRYTAARIVDADILMLVALPKGLNVEEWLASNASAFYNHVSLFY 81

  Fly   365 GTISEFCTQSGCADMTGPGNRTYLWFDEKGKKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANE 429
            |.||||||.|.|..|.. .:..|.|.||||:|.:.:||||.||..:..||.::||.:.|||:..|
 Frog    82 GAISEFCTISSCPTMKA-WSIQYQWTDEKGRKKKCSAPQYADYAASIIQKILTDEDLVPTKHCKE 145

  Fly   430 FPGSFESIARKILRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETDVL 494
            ||.:|....:|..||.||::.|:|.:|::.:..|.||.|||..:.||......|.|:|.||..:.
 Frog   146 FPKTFRPSIQKTFRLLFHLLGHIYTSHYKTVVNLELHPHLNTLYLHLLLFCAEFQLLDSKEMSLS 210

  Fly   495 RDLEVALRLTDDTGGCQDATSTTSS 519
            .||..||..:..|      ..||.|
 Frog   211 EDLTTALIRSSPT------PKTTGS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 73/165 (44%)
mob2.2NP_001008166.1 Mob1_phocein 43..208 CDD:367587 73/165 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 1 1.000 - - FOG0005522
OrthoInspector 1 1.000 - - otm48280
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.