DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and mob2a

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_005170738.1 Gene:mob2a / 436637 ZFINID:ZDB-GENE-040718-56 Length:230 Species:Danio rerio


Alignment Length:225 Identity:106/225 - (47%)
Similarity:132/225 - (58%) Gaps:13/225 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 KARRKERDGDQNSTDTKLYLEESVLERKLPEADLKALVDLPA-GLDYNEWLASHTLALFEHVNLV 363
            |::.|.........:.|.|||....:.::.:.|||.||.||. .:|.||||||:|...|..:||.
Zfish    14 KSKTKPNGKKAPPEEKKHYLEPEYTKVRVADFDLKDLVALPTKEIDLNEWLASNTTTFFNLINLQ 78

  Fly   364 YGTISEFCTQSGCADMTGPGNRTYLWFDEKGKKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYAN 428
            |.|||||||...|..||. .|..|.|:||:||||:..||||:|.||||.||.|:||.||||||..
Zfish    79 YSTISEFCTGDTCQAMTA-YNTIYYWYDERGKKTKCTAPQYVDLVMTFVQKLVTDEEIFPTKYGK 142

  Fly   429 EFPGSFESIARKILRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETDV 493
            :||.||||:.:|:.|..|||:||:|.|||:||..|.|..|||..:||.....|.|||||.|||.:
Zfish   143 DFPNSFESLVKKVCRYLFHVLAHIYWAHFKEIVALDLQGHLNTLYAHFIVFIREFNLIDPKETCI 207

  Fly   494 LRDLEVALRLTDDTGGCQDATSTTSSVHDH 523
            :.||...|        |.....|   .|:|
Zfish   208 MDDLSEVL--------CAPLPPT---AHNH 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 93/166 (56%)
mob2aXP_005170738.1 Mob1_phocein 46..205 CDD:281617 91/159 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 184 1.000 Domainoid score I3352
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 1 1.000 - - FOG0005522
OrthoInspector 1 1.000 - - otm25802
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3943
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.