DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and Mob3b

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001102440.1 Gene:Mob3b / 366352 RGDID:1560696 Length:216 Species:Rattus norvegicus


Alignment Length:168 Identity:67/168 - (39%)
Similarity:98/168 - (58%) Gaps:2/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 DLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPGNRTYLWFDE-KGK 395
            ||:|.|.||:|.|.|:|:|.|.:..|..:||:||||.||||:..|..|:|.....|.|.|: |.|
  Rat    43 DLRAAVQLPSGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYK 107

  Fly   396 K-TRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKILRLQFHVIAHLYAAHFRE 459
            | |.:.||||::.:|.:.:..:::|.||||.....||.:|..|.:|||...|.|..|:|..||..
  Rat   108 KPTALPAPQYMNLLMDWIEVQINNEDIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDR 172

  Fly   460 IALLGLHTHLNLTFAHLTALHRRFNLIDEKETDVLRDL 497
            :.::|...|:|..:.|........||||.||.:.|:::
  Rat   173 VIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEM 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 66/163 (40%)
Mob3bNP_001102440.1 Mob1_phocein 35..207 CDD:397617 66/163 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.