DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and Mob1b

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001101827.1 Gene:Mob1b / 360920 RGDID:1305114 Length:216 Species:Rattus norvegicus


Alignment Length:175 Identity:70/175 - (40%)
Similarity:102/175 - (58%) Gaps:2/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 ERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPGNRTYLW 389
            |..|...:|:..|.||.|.|.|||:|.:|:..|..:|::||||::|||:..|..|:......|.|
  Rat    33 EATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHW 97

  Fly   390 FDEKG--KKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKILRLQFHVIAHL 452
            .|...  |..:.:||:||||:||:.|..:.||::||:|....||.:|.|:|:.||:..|.|.||:
  Rat    98 ADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHI 162

  Fly   453 YAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETDVLRDL 497
            |..||..:..|....|||.:|.|.....:.|||||.:|...|::|
  Rat   163 YHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQEL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 67/167 (40%)
Mob1bNP_001101827.1 Mob1_phocein 33..204 CDD:397617 68/170 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.