DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and mob1

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_595191.1 Gene:mob1 / 2540845 PomBaseID:SPBC428.13c Length:210 Species:Schizosaccharomyces pombe


Alignment Length:197 Identity:72/197 - (36%)
Similarity:109/197 - (55%) Gaps:8/197 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 RKERDGDQNSTDTKLYLEESVLERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTI 367
            ||...|      ||.|......|..|....|...|.||.|.|.|||:|.:|:..:..:|::||||
pombe    15 RKTEAG------TKHYQLRQYAEATLGSGSLMEAVKLPKGEDLNEWIAMNTMDFYTQINMLYGTI 73

  Fly   368 SEFCTQSGCADMTGPGNRTYLWFDEK--GKKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEF 430
            :||||.:.|..|....:..|.|.|:|  .|.||::||.||:.::.:||:.:.|:.:|||:...||
pombe    74 TEFCTAASCPQMNAGPSYEYYWQDDKIYTKPTRMSAPDYINNLLDWTQEKLDDKKLFPTEIGVEF 138

  Fly   431 PGSFESIARKILRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETDVLR 495
            |.:|..:.::|.|..|.:.||:|.:||..:..:.|.::||.:|.|.....|.|.|:|.||...::
pombe   139 PKNFRKVIQQIFRRLFRIYAHIYCSHFHVMVAMELESYLNTSFKHFVFFCREFGLMDNKEYAPMQ 203

  Fly   496 DL 497
            ||
pombe   204 DL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 63/167 (38%)
mob1NP_595191.1 Mob1_phocein 31..202 CDD:281617 64/170 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.