DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and mob2

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_587851.1 Gene:mob2 / 2539016 PomBaseID:SPCC970.04c Length:244 Species:Schizosaccharomyces pombe


Alignment Length:256 Identity:78/256 - (30%)
Similarity:122/256 - (47%) Gaps:22/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 NNITNSSNNNHSGGHIIMSPTSQAPTRTSLFDSCHRKIRLIGGGPVAFLGGLVAKARRKERDGDQ 310
            |:::..:..|.|..|..:|..|.:....|...|..:.:                      |.|..
pombe     5 NSLSRITRGNRSKRHQNLSDASSSSGSFSKKSSTSQLV----------------------RTGSP 47

  Fly   311 NSTDTKLYLEESVLERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSG 375
            :...|.|||::..:...|.:.:...:|.||..:|.:||:|.:...||.::|..|...:.|||...
pombe    48 SVEPTALYLQQPFVRTHLVKGNFSTIVSLPRFVDLDEWVALNVYELFTYLNHFYDVFATFCTVKT 112

  Fly   376 CADMTGPGNRTYLWFDEKGKKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARK 440
            |..|:...|..|.|.|...|...:.|||||:||:.:.:..:.|:::||||....||.:|..|.:.
pombe   113 CPVMSAAANFDYTWLDNNRKPVHLPAPQYIEYVLAWIENRLHDQNVFPTKAGLPFPSNFLVIVKA 177

  Fly   441 ILRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETDVLRDLEVAL 501
            |.:..|.:.||:|.||:.||..|.|..|.|..|||..|..:.|.|:|:::|..|:||.|.|
pombe   178 IYKQMFRIFAHMYYAHYAEILHLSLEAHWNSFFAHFIAFGKEFQLLDKRDTAPLKDLIVVL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 59/165 (36%)
mob2NP_587851.1 Mob1_phocein 65..231 CDD:281617 59/165 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.