DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and Mob2

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001361564.1 Gene:Mob2 / 101513 MGIID:1919891 Length:266 Species:Mus musculus


Alignment Length:229 Identity:102/229 - (44%)
Similarity:137/229 - (59%) Gaps:3/229 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 LVAKARRKERDGDQNSTDTKLYLEESVLERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVN 361
            ::.|::.|.......:.:.|:|||....:.::.:.:.|.||.||..:|.||||||:|...|.|:|
Mouse    35 VLRKSKAKPNGKKPAAEEKKVYLEPEHTKSRITDFEFKELVVLPREIDLNEWLASNTTTFFHHIN 99

  Fly   362 LVYGTISEFCTQSGCADMTGPGNRTYLWFDEKGKKTRVAAPQYIDYVMTFTQKTVSDESIFPTKY 426
            |.|.|||||||...|..| ...|..|.|:||:|||.:..||||:|:||:..||.|:||.:|||||
Mouse   100 LQYSTISEFCTGETCQTM-AVCNTQYYWYDERGKKVKCTAPQYVDFVMSSVQKLVTDEDVFPTKY 163

  Fly   427 ANEFPGSFESIARKILRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKET 491
            ..|||.||||:.:||.:..|||:.|:|.|||:|...|.||.|||..:.|.....|.|||:|.|||
Mouse   164 GREFPSSFESLVKKICKYLFHVLGHIYWAHFKETLALELHGHLNTLYVHFILFAREFNLLDPKET 228

  Fly   492 DVLRDL-EVALRLTDDTGGCQD-ATSTTSSVHDH 523
            .|:.|| ||......::|...| |.|..|...:|
Mouse   229 AVMDDLTEVLCSSPGNSGATGDGANSGASGAQNH 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 85/165 (52%)
Mob2NP_001361564.1 Mob1_phocein 63..231 CDD:397617 85/167 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 184 1.000 Domainoid score I3414
eggNOG 1 0.900 - - E1_KOG0440
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 1 1.000 - - FOG0005522
OrthoInspector 1 1.000 - - oto93119
orthoMCL 1 0.900 - - OOG6_107229
Panther 1 1.100 - - LDO PTHR22599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4664
SonicParanoid 1 1.000 - - X3943
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.