Sequence 1: | NP_729715.2 | Gene: | Mob2 / 39293 | FlyBaseID: | FBgn0259481 | Length: | 728 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021331635.1 | Gene: | mob1a / 100005014 | ZFINID: | ZDB-GENE-030131-6506 | Length: | 241 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 74/200 - (37%) |
---|---|---|---|
Similarity: | 106/200 - (53%) | Gaps: | 27/200 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 325 ERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPGNRTYLW 389
Fly 390 FDEKG--KKTRVAAPQYIDYVMTFTQKTVSDESIFPTK--------YANE--------------- 429
Fly 430 --FPGSFESIARKILRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETD 492
Fly 493 VLRDL 497 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Mob2 | NP_729715.2 | Mob1_phocein | 328..494 | CDD:281617 | 70/192 (36%) |
mob1a | XP_021331635.1 | Mob1_phocein | 33..229 | CDD:308952 | 71/195 (36%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1127941at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |