DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mob2 and mob1a

DIOPT Version :9

Sequence 1:NP_729715.2 Gene:Mob2 / 39293 FlyBaseID:FBgn0259481 Length:728 Species:Drosophila melanogaster
Sequence 2:XP_021331635.1 Gene:mob1a / 100005014 ZFINID:ZDB-GENE-030131-6506 Length:241 Species:Danio rerio


Alignment Length:200 Identity:74/200 - (37%)
Similarity:106/200 - (53%) Gaps:27/200 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 ERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPGNRTYLW 389
            |..|...:|:|.|.||.|.|.|||:|.:|:..|..:|::||||:||||:..|:.|:......|.|
Zfish    33 EATLGSGNLRAAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEVKCSVMSAGPRYEYHW 97

  Fly   390 FDEKG--KKTRVAAPQYIDYVMTFTQKTVSDESIFPTK--------YANE--------------- 429
            .|...  |..:.:||:||||:||:.|..:.||::||:|        |.:.               
Zfish    98 ADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGLYGYIGYEHRGAVKPFHTIFLLVPG 162

  Fly   430 --FPGSFESIARKILRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDEKETD 492
              ||.:|.|:|:.||:..|.|.||:|..||..:..|....|||.:|.|.....:.|||||.:|..
Zfish   163 VPFPKNFMSVAKTILKRLFRVYAHIYHQHFDAVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELA 227

  Fly   493 VLRDL 497
            .|:||
Zfish   228 PLQDL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mob2NP_729715.2 Mob1_phocein 328..494 CDD:281617 70/192 (36%)
mob1aXP_021331635.1 Mob1_phocein 33..229 CDD:308952 71/195 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1127941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.