DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chrb and DDIT4

DIOPT Version :9

Sequence 1:NP_648470.2 Gene:chrb / 39284 FlyBaseID:FBgn0036165 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_061931.1 Gene:DDIT4 / 54541 HGNCID:24944 Length:232 Species:Homo sapiens


Alignment Length:225 Identity:58/225 - (25%)
Similarity:88/225 - (39%) Gaps:70/225 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 SSTAQQHHPLPASP------------------------LQSTAC-------ARFGAADN---LDD 165
            |||:.....||.:|                        |:|:.|       :.||..::   ||.
Human    11 SSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSSNSGFGPEEDTAYLDG 75

  Fly   166 VS---------------ASAVRELSQQLQAQLRDAKRRHLACTEVTLPNDLTQRIAAEIIRMSER 215
            ||               .:.:.:|.|:..||.|...||.   ..:.:|:.|..::..|::|::..
Human    76 VSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRP---ARLLMPSQLVSQVGKELLRLAYS 137

  Fly   216 EPCGERACTLFIEFESEPNKVKRIAYFKVDPDTVSIFELYLTLRQDKSGW-----------SSLV 269
            ||||.|...|.:..| :......:....:||..|..|:|.|.||.|...|           |..:
Human   138 EPCGLRGALLDVCVE-QGKSCHSVGQLALDPSLVPTFQLTLVLRLDSRLWPKIQGLFSSANSPFL 201

  Fly   270 PQFIKNLTRSNTINISPDFTLTKKKLYSSE 299
            |.|.::||      :|..|.:.||||||||
Human   202 PGFSQSLT------LSTGFRVIKKKLYSSE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chrbNP_648470.2 RTP801_C 182..297 CDD:285100 35/125 (28%)
DDIT4NP_061931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 11/59 (19%)
RTP801_C 104..223 CDD:400249 37/128 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147616
Domainoid 1 1.000 79 1.000 Domainoid score I8669
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5375
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588396at2759
OrthoFinder 1 1.000 - - FOG0004358
OrthoInspector 1 1.000 - - mtm8660
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12478
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.