DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chrb and si:ch211-39i2.2

DIOPT Version :9

Sequence 1:NP_648470.2 Gene:chrb / 39284 FlyBaseID:FBgn0036165 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001245246.1 Gene:si:ch211-39i2.2 / 449866 ZFINID:ZDB-GENE-041008-126 Length:202 Species:Danio rerio


Alignment Length:165 Identity:51/165 - (30%)
Similarity:79/165 - (47%) Gaps:23/165 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 PLQSTACAR---------FGAADNLDDVSASAV---RELSQQLQAQLRDAKRRHLACTEVTLPND 200
            |||.  |.|         .|:|.:|::.....|   .:||::::..|.:||...|.|.|:.||..
Zfish    38 PLQH--CGRLMKAQSFSSLGSACSLEEEEGEDVCLQLDLSKRIEKCLYEAKGASLRCQELRLPRH 100

  Fly   201 LTQRIAAEIIRMSEREPCGERACTLFIEFESEPNKVKRIAYFKVDPD--TVSIFELYLTLRQDKS 263
            :|.|:|.:|:|:|..||||.|...:.:..|   ||...:....|.||  ....||:.:.|:.|..
Zfish   101 MTTRLAGDILRLSVDEPCGIRGALIHMYME---NKGTLLNLGTVIPDQSLTPTFEVSVVLQADLG 162

  Fly   264 GWSSLVPQFIKNLTRSNTINISPDFTLTKKKLYSS 298
            ||..|...|    .....::|..::.:.|:|||||
Zfish   163 GWPPLKILF----GGGKVLSIRREYRIIKRKLYSS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chrbNP_648470.2 RTP801_C 182..297 CDD:285100 37/116 (32%)
si:ch211-39i2.2NP_001245246.1 RTP801_C 82..192 CDD:285100 37/116 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.