DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chrb and ddit4

DIOPT Version :9

Sequence 1:NP_648470.2 Gene:chrb / 39284 FlyBaseID:FBgn0036165 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_956401.1 Gene:ddit4 / 378866 ZFINID:ZDB-GENE-031002-35 Length:220 Species:Danio rerio


Alignment Length:214 Identity:62/214 - (28%)
Similarity:89/214 - (41%) Gaps:33/214 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 TSPVAAASFEAP---LSGGSAAAYHHAYMTNVLSSTAQQHHPLPASPLQSTACARFGAADNLDDV 166
            :||....| :||   ||........|:  :..|.|.:..|.....|....:.|        :.||
Zfish    14 SSPSTPTS-DAPAKRLSWSKLMQKLHS--SQSLDSDSDNHSSTDDSSDSGSIC--------IPDV 67

  Fly   167 SAS---------AVRELSQQLQAQLRDAKRRHLACTEVTLPNDLTQRIAAEIIRMSEREPCGERA 222
            |.|         ..:|:.|.:...|.|||...|.|:::.:|..|.:.|..|::.:|..||||.|.
Zfish    68 SQSEFFDPTEEALCKEVVQLIALNLTDAKDGVLHCSKLLIPEKLLEHIGQELVHLSVSEPCGLRG 132

  Fly   223 C--TLFIEFESEPNKVKRIAYFKVDPDTVSIFELYLTLRQDKSG-WSSLVPQFIKNLTRS----N 280
            .  .|.:|.:...:...:||   |||..|..|:|.|.||.|..| |..:...|......|    .
Zfish   133 ALIDLCVEQDGSCHAAAQIA---VDPYLVPTFQLTLVLRLDSRGLWPKIQGLFTGRSPASPAVRR 194

  Fly   281 TINISPDFTLTKKKLYSSE 299
            .:.:|..|...|:||||||
Zfish   195 ALRLSTGFRAIKRKLYSSE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chrbNP_648470.2 RTP801_C 182..297 CDD:285100 39/121 (32%)
ddit4NP_956401.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 12/50 (24%)
RTP801_C 92..211 CDD:285100 39/121 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581425
Domainoid 1 1.000 57 1.000 Domainoid score I10890
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5364
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588396at2759
OrthoFinder 1 1.000 - - FOG0004358
OrthoInspector 1 1.000 - - otm26257
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12478
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.