DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chrb and Ddit4

DIOPT Version :9

Sequence 1:NP_648470.2 Gene:chrb / 39284 FlyBaseID:FBgn0036165 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_543182.1 Gene:Ddit4 / 140942 RGDID:621731 Length:229 Species:Rattus norvegicus


Alignment Length:184 Identity:55/184 - (29%)
Similarity:80/184 - (43%) Gaps:40/184 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 LQSTAC-------ARFGAADN---LDDVSASAVRELS------------QQLQAQLRDAKRRHLA 191
            |:|:.|       :.||..::   ||.||......||            |.||..|..|:.....
  Rat    46 LESSDCESLDSSNSGFGPEEDSSYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLSQARLGSRR 110

  Fly   192 CTEVTLPNDLTQRIAAEIIRMSEREPCGERACTLFIEFESEPNKVKRIAYFKVDPDTVSIFELYL 256
            ...:.:|:.|..::..|::|::..||||.|...|.:..| :......:|...:||..|..|:|.|
  Rat   111 PARLLMPSQLLSQVGKELLRLAYSEPCGLRGALLDVCVE-QGKSCHSVAQLALDPSLVPTFQLTL 174

  Fly   257 TLRQDKSGW-----------SSLVPQFIKNLTRSNTINISPDFTLTKKKLYSSE 299
            .||.|...|           |||||.:.::||      :|..|.:.||||||||
  Rat   175 VLRLDSRLWPKIQGLLSSANSSLVPGYSQSLT------LSTGFRVIKKKLYSSE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chrbNP_648470.2 RTP801_C 182..297 CDD:285100 37/125 (30%)
Ddit4NP_543182.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..68 5/21 (24%)
RTP801_C 101..220 CDD:285100 37/125 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5138
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588396at2759
OrthoFinder 1 1.000 - - FOG0004358
OrthoInspector 1 1.000 - - mtm9140
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12478
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.