DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chrb and DDIT4L

DIOPT Version :9

Sequence 1:NP_648470.2 Gene:chrb / 39284 FlyBaseID:FBgn0036165 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_660287.1 Gene:DDIT4L / 115265 HGNCID:30555 Length:193 Species:Homo sapiens


Alignment Length:142 Identity:51/142 - (35%)
Similarity:75/142 - (52%) Gaps:7/142 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 NLDDV--SASAVRELSQQLQAQLRDAKRRHLACTEVTLPNDLTQRIAAEIIRMSEREPCGERACT 224
            ||::|  ..|..:.|.:.|:..|..:|:..|.|::|.:|..||||||.:::|:|..||||.|.|.
Human    43 NLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCV 107

  Fly   225 LFIEFESEPNKVKRIAYFKVDPDTVSIFELYLTLRQDKSGWSSLVPQFIKNLTRSN----TINIS 285
            :.:..|.| |..|::.....|...|..|||.|..:|:...|:|....|......|:    |:.:|
Human   108 MHVNLEIE-NVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILS 171

  Fly   286 PDFTLTKKKLYS 297
            ..|.|.||||||
Human   172 SGFRLVKKKLYS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chrbNP_648470.2 RTP801_C 182..297 CDD:285100 43/118 (36%)
DDIT4LNP_660287.1 RTP801_C 65..183 CDD:400249 43/118 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147617
Domainoid 1 1.000 79 1.000 Domainoid score I8669
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5375
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588396at2759
OrthoFinder 1 1.000 - - FOG0004358
OrthoInspector 1 1.000 - - mtm8660
orthoMCL 1 0.900 - - OOG6_109004
Panther 1 1.100 - - O PTHR12478
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4511
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.