DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chrb and ddit4l

DIOPT Version :9

Sequence 1:NP_648470.2 Gene:chrb / 39284 FlyBaseID:FBgn0036165 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_004911505.2 Gene:ddit4l / 101733493 XenbaseID:XB-GENE-6040115 Length:164 Species:Xenopus tropicalis


Alignment Length:161 Identity:48/161 - (29%)
Similarity:71/161 - (44%) Gaps:16/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 PLQSTACARFGAADNLDDV-SASAVRELSQQLQAQLRDAKRRHLACTEVTLPNDLTQRIAAEIIR 211
            |..|.:...|..|..:.|. :......|:..|:..|.:||...|.||::.:|..|..|:|.||::
 Frog     3 PAGSNSLEYFSNAMTVQDAFTVMRTYHLASMLENCLYNAKCTKLHCTKILVPKGLLTRVAQEILK 67

  Fly   212 MSEREPCGERACTLFIEFESEPNKVKRIAYFKVDPDTVSIFELYLTLRQDKSGWSSLVPQF---- 272
            .|..||||.|.|.|.:..|. .:|...:.....|......||:.|.|:::    |.|:..|    
 Frog    68 FSFTEPCGLRGCILHVNLEC-GHKHLALGTLAYDSTVEPTFEVTLVLKRE----SQLLDHFSDFL 127

  Fly   273 -----IKNLTRSNTINISPDFTLTKKKLYSS 298
                 ..:|.| ..:.:||.|.|||..||.|
 Frog   128 IPGTWFPSLFR-GILKLSPKFLLTKNSLYFS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chrbNP_648470.2 RTP801_C 182..297 CDD:285100 39/123 (32%)
ddit4lXP_004911505.2 RTP801_C 41..155 CDD:400249 37/119 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10125
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5226
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1588396at2759
OrthoFinder 1 1.000 - - FOG0004358
OrthoInspector 1 1.000 - - mtm9556
Panther 1 1.100 - - O PTHR12478
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.