DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-2 and VMA3

DIOPT Version :9

Sequence 1:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_010887.3 Gene:VMA3 / 856686 SGDID:S000000753 Length:160 Species:Saccharomyces cerevisiae


Alignment Length:148 Identity:98/148 - (66%)
Similarity:116/148 - (78%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIAIYGLVV 74
            |.||.|.|..|.|.|||||:|||:||||.|||||....|.|||::.|.|:||:||||||||||||
Yeast     6 PVYAPFFGAIGCASAIIFTSLGAAYGTAKSGVGICATCVLRPDLLFKNIVPVIMAGIIAIYGLVV 70

  Fly    75 SVLIAGSIGDDYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPRLFVGMVLILIF 139
            |||:..|:|....:...::.|||||||||.||.||.||||.|||||||:::||||||||:|||||
Yeast    71 SVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSSQQPRLFVGMILILIF 135

  Fly   140 AEVLALYGLIVAIYLYTK 157
            ||||.|||||||:.|.::
Yeast   136 AEVLGLYGLIVALLLNSR 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 95/144 (66%)
ATP-synt_C 15..120 CDD:294318 66/104 (63%)
ATP-synt_C 94..154 CDD:278563 48/59 (81%)
VMA3NP_010887.3 V_ATP_synt_C 11..116 CDD:130170 66/104 (63%)
ATP-synt_Vo_c_ATP6C_rpt2 84..151 CDD:349416 48/66 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342243
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 1 1.010 - - QHG53914
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
TreeFam 1 0.960 - -
109.760

Return to query results.
Submit another query.