DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-2 and VMA11

DIOPT Version :9

Sequence 1:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_015090.1 Gene:VMA11 / 855842 SGDID:S000006155 Length:164 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:85/150 - (56%)
Similarity:114/150 - (76%) Gaps:2/150 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIAIYGLVV 74
            |.||.|.|..|.|.|::.:.|||:.|||.||:|||.:...:|::|||::|||||:||:|||||||
Yeast    12 PLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSLIPVVMSGILAIYGLVV 76

  Fly    75 SVLIAGSIG--DDYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPRLFVGMVLIL 137
            :|||||::.  :|||:.:.::||..||.||...|::|.|||:.||.|||....|||||||:||||
Yeast    77 AVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVGDVGVRKYMHQPRLFVGIVLIL 141

  Fly   138 IFAEVLALYGLIVAIYLYTK 157
            ||:|||.|||:|||:.|.|:
Yeast   142 IFSEVLGLYGMIVALILNTR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 82/145 (57%)
ATP-synt_C 15..120 CDD:294318 55/106 (52%)
ATP-synt_C 94..154 CDD:278563 38/59 (64%)
VMA11NP_015090.1 ATP-synt_C 17..124 CDD:412393 55/106 (52%)
ATP-synt_Vo_c_ATP6C_rpt2 92..159 CDD:349416 38/66 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 1 1.010 - - QHG53914
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.