DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-2 and VHA-C3

DIOPT Version :9

Sequence 1:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_195603.1 Gene:VHA-C3 / 830047 AraportID:AT4G38920 Length:164 Species:Arabidopsis thaliana


Alignment Length:146 Identity:86/146 - (58%)
Similarity:114/146 - (78%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIAIYGLVVSVLIA 79
            |.|..|||.|::|:.:||:||||.||||:|.|.|.||:::||:|:||||||::.||||:::|:|:
plant    12 FFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIIS 76

  Fly    80 GSI---GDDYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPRLFVGMVLILIFAE 141
            ..|   ...|.:.|.|.||.:||:.||.||:||:||||.||||||..|:||:|||||:|||||||
plant    77 TGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAE 141

  Fly   142 VLALYGLIVAIYLYTK 157
            .||||||||.|.|.::
plant   142 ALALYGLIVGIILSSR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 86/146 (59%)
ATP-synt_C 15..120 CDD:294318 58/107 (54%)
ATP-synt_C 94..154 CDD:278563 44/59 (75%)
VHA-C3NP_195603.1 V_ATP_synt_C 12..120 CDD:130170 58/107 (54%)
ATP-synt_Vo_c_ATP6C_rpt2 88..155 CDD:349416 46/66 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2684
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1314
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm8409
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X666
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.