DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-2 and ATP6V0B

DIOPT Version :9

Sequence 1:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001281262.1 Gene:ATP6V0B / 533 HGNCID:861 Length:261 Species:Homo sapiens


Alignment Length:159 Identity:48/159 - (30%)
Similarity:84/159 - (52%) Gaps:20/159 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AFFLGCT--------GAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIAI 69
            |:||..|        |..:||..:.:||::|..::|..|....|..|.:..|.::.::....:||
Human    38 AWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAI 102

  Fly    70 YGLVVSVLIAGSIGDDYTMED-----------SYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGT 123
            ||::::::|: ::.:.::..|           .|...||||:|||..|..||.:||.|.......
Human   103 YGIIMAIVIS-NMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALAD 166

  Fly   124 AEQPRLFVGMVLILIFAEVLALYGLIVAI 152
            |:.|.|||.::::.||...:.|:|:||||
Human   167 AQNPSLFVKILIVEIFGSAIGLFGVIVAI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 47/158 (30%)
ATP-synt_C 15..120 CDD:294318 34/123 (28%)
ATP-synt_C 94..154 CDD:278563 26/59 (44%)
ATP6V0BNP_001281262.1 PRK08344 48..199 CDD:236246 44/149 (30%)
ATP-synt_C 52..112 CDD:278563 15/59 (25%)
ATP-synt_C 136..196 CDD:278563 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.