DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-2 and VhaPPA1-2

DIOPT Version :9

Sequence 1:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster


Alignment Length:160 Identity:51/160 - (31%)
Similarity:80/160 - (50%) Gaps:13/160 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIAIYGLVVS 75
            |..|.....|..:|...:.|||:.|..:.|..:|...|..|.:..|.:|.|:....:|||||:.:
  Fly    48 SNPFLWSGMGIFLACALSVLGAASGIYMIGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYGLITA 112

  Fly    76 VLIAGSIG--------DDYT-----MEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQP 127
            :|::|::.        .|.|     |...:...||||.||:..:..|:|:||.|.......|...
  Fly   113 ILLSGNVNKFSSVRLITDSTVMATNMFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALADAANS 177

  Fly   128 RLFVGMVLILIFAEVLALYGLIVAIYLYTK 157
            .|||.::::.||...:.|:|||||||:.:|
  Fly   178 ALFVKILIVEIFGSAIGLFGLIVAIYMTSK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 50/157 (32%)
ATP-synt_C 15..120 CDD:294318 34/117 (29%)
ATP-synt_C 94..154 CDD:278563 24/59 (41%)
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 33/109 (30%)
ATP-synt_C 143..204 CDD:278563 24/60 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453380
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.