DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-2 and atp6v0c

DIOPT Version :9

Sequence 1:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_988893.1 Gene:atp6v0c / 394488 XenbaseID:XB-GENE-981790 Length:156 Species:Xenopus tropicalis


Alignment Length:148 Identity:103/148 - (69%)
Similarity:121/148 - (81%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIAIYGLVV 74
            |.|:.|....||:.|::|:.|||:||||.||.|||.|:|.||::|||:|||||||||||||||||
 Frog     9 PEYSAFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVV 73

  Fly    75 SVLIAGSIGDDYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPRLFVGMVLILIF 139
            :||||.|:....|:..|::.|||||||||.||.||.||||.|||||||||:||||||||:|||||
 Frog    74 AVLIANSLTSSITLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIF 138

  Fly   140 AEVLALYGLIVAIYLYTK 157
            ||||.|||||||:.|.||
 Frog   139 AEVLGLYGLIVALILSTK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 101/144 (70%)
ATP-synt_C 15..120 CDD:294318 68/104 (65%)
ATP-synt_C 94..154 CDD:278563 50/59 (85%)
atp6v0cNP_988893.1 V_ATP_synt_C 14..119 CDD:130170 68/104 (65%)
ATP-synt_Vo_c_ATP6C_rpt2 87..154 CDD:349416 51/66 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.