DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-2 and Vha16-4

DIOPT Version :9

Sequence 1:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster


Alignment Length:150 Identity:90/150 - (60%)
Similarity:121/150 - (80%) Gaps:0/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EEPSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIAIYGL 72
            :||..|.|....||..||:|:||||:||||.:.|||:.|::..|.:|||||:|||||||||||||
  Fly     6 DEPQCASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIAIYGL 70

  Fly    73 VVSVLIAGSIGDDYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPRLFVGMVLIL 137
            |::||:|||:...|:....:::|.|||:||:.|:.||:|||:.|:||||.:|:||:|||.::|||
  Fly    71 VIAVLLAGSLSSPYSAYKGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVRASAQQPKLFVAIILIL 135

  Fly   138 IFAEVLALYGLIVAIYLYTK 157
            ||||||.||||||||||::|
  Fly   136 IFAEVLGLYGLIVAIYLFSK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 86/143 (60%)
ATP-synt_C 15..120 CDD:294318 58/104 (56%)
ATP-synt_C 94..154 CDD:278563 40/59 (68%)
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 58/104 (56%)
ATP-synt_C 93..152 CDD:278563 40/58 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444262
Domainoid 1 1.000 89 1.000 Domainoid score I2684
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1314
Isobase 1 0.950 - 0 Normalized mean entropy S170
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm1110
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
1110.850

Return to query results.
Submit another query.