DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-2 and vma11

DIOPT Version :9

Sequence 1:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_593600.1 Gene:vma11 / 2541780 PomBaseID:SPAC732.01 Length:162 Species:Schizosaccharomyces pombe


Alignment Length:150 Identity:83/150 - (55%)
Similarity:111/150 - (74%) Gaps:2/150 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIAIYGLVV 74
            |.|:.|.|..|...:::|:.|||.||||::|.|||.:...||:::||::|||||:|||.:||||:
pombe     7 PIYSSFFGFAGVCASMVFSCLGAGYGTALAGRGIAAVGAFRPEIVMKSLIPVVMSGIIGVYGLVM 71

  Fly    75 SVLIAGSIG--DDYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPRLFVGMVLIL 137
            ||||||.:.  :||::...::||.|||:|||.|:.||.|||:.||.||:....|.|:||.|||||
pombe    72 SVLIAGDMSPDNDYSLFSGFIHLSAGLAVGLTGVAAGYAIGVVGDRGVQSFMRQDRIFVSMVLIL 136

  Fly   138 IFAEVLALYGLIVAIYLYTK 157
            ||||||.||||||.:.|.||
pombe   137 IFAEVLGLYGLIVGLILQTK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 80/145 (55%)
ATP-synt_C 15..120 CDD:294318 55/106 (52%)
ATP-synt_C 94..154 CDD:278563 39/59 (66%)
vma11NP_593600.1 ATP-synt_C 12..119 CDD:294318 55/106 (52%)
ATP-synt_C 93..153 CDD:278563 39/59 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.