powered by:
Protein Alignment Vha16-2 and Atp5g3
DIOPT Version :9
Sequence 1: | NP_729707.1 |
Gene: | Vha16-2 / 39282 |
FlyBaseID: | FBgn0028668 |
Length: | 158 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001288650.1 |
Gene: | Atp5g3 / 228033 |
MGIID: | 2442035 |
Length: | 141 |
Species: | Mus musculus |
Alignment Length: | 65 |
Identity: | 20/65 - (30%) |
Similarity: | 33/65 - (50%) |
Gaps: | 7/65 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 LGAG-LSVGLPGLTAGVAIGIAGDAGVRGTAEQP----RLFVGMVLILIFAEVLALYGLIVAIYL 154
:||| .:||:.| :|..||....:.:.|.|..| :||...:|....:|.:.|:.|:||..:
Mouse 75 IGAGAATVGVAG--SGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 137
Fly 155 154
Mouse 138 137
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0636 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.