DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-2 and atp6v0ca

DIOPT Version :9

Sequence 1:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001098606.2 Gene:atp6v0ca / 192336 ZFINID:ZDB-GENE-020419-23 Length:154 Species:Danio rerio


Alignment Length:150 Identity:105/150 - (70%)
Similarity:125/150 - (83%) Gaps:0/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EEPSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIAIYGL 72
            :.|.|:.|....||:.|::|:.|||:||||.||.|||.|:|.||::|||:|||||||||||||||
Zfish     4 QNPQYSPFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGL 68

  Fly    73 VVSVLIAGSIGDDYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPRLFVGMVLIL 137
            ||:||||.:|||..::..|::||||||||||.||.||.||||.|||||||||:||||||||:|||
Zfish    69 VVAVLIANNIGDKISLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILIL 133

  Fly   138 IFAEVLALYGLIVAIYLYTK 157
            ||||||.|||||||:.|.||
Zfish   134 IFAEVLGLYGLIVALILSTK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 102/143 (71%)
ATP-synt_C 15..120 CDD:294318 70/104 (67%)
ATP-synt_C 94..154 CDD:278563 51/59 (86%)
atp6v0caNP_001098606.2 V_ATP_synt_C 11..116 CDD:130170 70/104 (67%)
PRK14893 12..154 CDD:184887 101/141 (72%)
ATP-synt_C 90..151 CDD:278563 51/60 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576803
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.