DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-2 and vha-3

DIOPT Version :9

Sequence 1:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001367642.1 Gene:vha-3 / 177018 WormBaseID:WBGene00006912 Length:161 Species:Caenorhabditis elegans


Alignment Length:152 Identity:95/152 - (62%)
Similarity:114/152 - (75%) Gaps:3/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EEPSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIAIYGL 72
            |..:||.|.|..|||.|.|||.|||:||||.|.|||..|.|.||::|||::|||:|||||.||||
 Worm     9 ERAAYAPFFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIYGL 73

  Fly    73 VVSVLIAG---SIGDDYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPRLFVGMV 134
            ||::::.|   |....|.:...:.||.|||:.||.||.||.||||.|||||||||:||||||||:
 Worm    74 VVAMVLKGKVTSASAGYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVGDAGVRGTAQQPRLFVGMI 138

  Fly   135 LILIFAEVLALYGLIVAIYLYT 156
            |||||:|||.|||:|||:.|.|
 Worm   139 LILIFSEVLGLYGMIVALILGT 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 92/146 (63%)
ATP-synt_C 15..120 CDD:294318 62/107 (58%)
ATP-synt_C 94..154 CDD:278563 46/59 (78%)
vha-3NP_001367642.1 V_ATP_synt_C 16..124 CDD:130170 62/107 (58%)
ATP-synt_Vo_c_ATP6C_rpt2 92..158 CDD:349416 46/65 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I2374
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 1 1.000 - - mtm4729
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.