DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-2 and Atp5mc2

DIOPT Version :9

Sequence 1:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_598240.1 Gene:Atp5mc2 / 171082 RGDID:620051 Length:141 Species:Rattus norvegicus


Alignment Length:117 Identity:28/117 - (23%)
Similarity:49/117 - (41%) Gaps:23/117 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GIAKMAVNRPDMIMKAIIPVVMAGIIAIYGLVVSVLIAGSIGDDYTMEDSYVHLGAGLSVGLPGL 106
            |::.:||.||   :.::||             .......:|..|......::..||. :||:.| 
  Rat    40 GLSCLAVRRP---LTSLIP-------------SRSFQTSAISRDIDTAAKFIGAGAA-TVGVAG- 86

  Fly   107 TAGVAIGIAGDAGVRGTAEQP----RLFVGMVLILIFAEVLALYGLIVAIYL 154
             :|..||....:.:.|.|..|    :||...:|....:|.:.|:.|:||..:
  Rat    87 -SGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 28/117 (24%)
ATP-synt_C 15..120 CDD:294318 17/77 (22%)
ATP-synt_C 94..154 CDD:278563 19/63 (30%)
Atp5mc2NP_598240.1 ATP9 67..141 CDD:164765 20/74 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.