DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-2 and Atp6v0c

DIOPT Version :9

Sequence 1:NP_729707.1 Gene:Vha16-2 / 39282 FlyBaseID:FBgn0028668 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_570836.1 Gene:Atp6v0c / 170667 RGDID:621394 Length:155 Species:Rattus norvegicus


Alignment Length:154 Identity:105/154 - (68%)
Similarity:125/154 - (81%) Gaps:0/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AALNEEPSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNRPDMIMKAIIPVVMAGIIA 68
            |.:...|.|:.|.|..||:.|::|:.:||:||||.||.|||.|:|.||::|||:|||||||||||
  Rat     2 ADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIA 66

  Fly    69 IYGLVVSVLIAGSIGDDYTMEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPRLFVGM 133
            ||||||:||||.|:.|..|:..|::.|||||||||.||.||.||||.|||||||||:||||||||
  Rat    67 IYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGM 131

  Fly   134 VLILIFAEVLALYGLIVAIYLYTK 157
            :|||||||||.|||||||:.|.||
  Rat   132 ILILIFAEVLGLYGLIVALILSTK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-2NP_729707.1 PRK06558 14..158 CDD:235830 102/144 (71%)
ATP-synt_C 15..120 CDD:294318 69/104 (66%)
ATP-synt_C 94..154 CDD:278563 50/59 (85%)
Atp6v0cNP_570836.1 V_ATP_synt_C 13..118 CDD:130170 69/104 (66%)
ATP-synt_Vo_c_ATP6C_rpt2 86..153 CDD:349416 51/66 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337651
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoDB 1 1.010 - - D1534092at2759
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X666
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.