DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and rbsK

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_418208.1 Gene:rbsK / 948260 ECOCYCID:EG10818 Length:309 Species:Escherichia coli


Alignment Length:341 Identity:69/341 - (20%)
Similarity:120/341 - (35%) Gaps:103/341 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TVLCIGTTTIDFVSTIKRFPEENSHQKVIGGYW--IRGGKASNNCTVLANLGVKVEFLGMLSSWS 78
            :::.:|:...|.:..::.||...  :.|.|.::  ..|||.:|........|..:.|:......|
E. coli     6 SLVVLGSINADHILNLQSFPTPG--ETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDS 68

  Fly    79 V-----FQVLVDDL----------KSRGIII-------DNCPTCDQGAPFS-SVILTKATKTR-- 118
            :     .|:..|::          :|.|:.:       :|......||..: |..|.:|.:.|  
E. coli    69 IGESVRQQLATDNIDITPVSVIKGESTGVALIFVNGEGENVIGIHAGANAALSPALVEAQRERIA 133

  Fly   119 --------------------NIVYCNNNFPYVSIDDFRKLNLNQYGWIHIRALYFDKSLPMVKDI 163
                                .|.:.|.....::....|:|.              |:.|.:| ||
E. coli   134 NASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPARELP--------------DELLALV-DI 183

  Fly   164 EAYNANRKEKIVLSMEFDNNLDDMWPLMDYCDYAVFSKKLAQPNGWVSLEDACMQLDERLRMRWG 228
            ...|....||:. .:..:|:.|              :.|.||            .|.|:     |
E. coli   184 ITPNETEAEKLT-GIRVENDED--------------AAKAAQ------------VLHEK-----G 216

  Fly   229 LNLKRPYVVVLWGDQGAGILDLNGNFTHVKPHKPKRIVDALGAGDTFVGAFIYALYIRERSVSVA 293
            :..    |::..|.:|.. ..:||....| |....:.||.:.|||||.||.|.|| :.|:.:..|
E. coli   217 IRT----VLITLGSRGVW-ASVNGEGQRV-PGFRVQAVDTIAAGDTFNGALITAL-LEEKPLPEA 274

  Fly   294 VDFGNRMASYKCTKNG 309
            :.|.:..|:...|:.|
E. coli   275 IRFAHAAAAIAVTRKG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 69/341 (20%)
rbsKNP_418208.1 PRK11142 4..308 CDD:236858 69/341 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.