DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and kdgK

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_417983.2 Gene:kdgK / 948041 ECOCYCID:EG12253 Length:309 Species:Escherichia coli


Alignment Length:348 Identity:68/348 - (19%)
Similarity:110/348 - (31%) Gaps:118/348 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KTVLCIGTTTIDFV---STIKRFPEENSHQKVIGGYWIRGGKASNNCTVLAN----LGVKVEFLG 72
            |.:..||...|:..   :.:||            |:   ||...|....:|.    ..:.|.::.
E. coli     3 KKIAVIGECMIELSEKGADVKR------------GF---GGDTLNTSVYIARQVDPAALTVHYVT 52

  Fly    73 MLSSWSVFQVLVDDLKSRGIIIDNCPTCDQGAPFSSVILTKATKTRNIVYCNN------------ 125
            .|.:.|..|.::|......:........:...|....|.|.:|..|...|..|            
E. coli    53 ALGTDSFSQQMLDAWHGENVDTSLTQRMENRLPGLYYIETDSTGERTFYYWRNEAAAKFWLESEQ 117

  Fly   126 ---------NFPYVSIDDFRKLNLNQYGWIHIRALYFDKSLPMVKDIEAYNANRKEKIVLSMEFD 181
                     ||.|        |.|:......:.....:|.|.::::..|...    |::    ||
E. coli   118 SAAICEELANFDY--------LYLSGISLAILSPTSREKLLSLLRECRANGG----KVI----FD 166

  Fly   182 NNLDDMWPLMDYCDYAVFSKKLAQPNGWVSLED--------------ACMQLDERLRMRWGLN-- 230
            ||.                    :|..|.|.|:              |.:.||:...: ||..  
E. coli   167 NNY--------------------RPRLWASKEETQQVYQQMLECTDIAFLTLDDEDAL-WGQQPV 210

  Fly   231 ---LKRPY------VVVLWGDQ-------GAGILDLNGNFTHVKPHKPKRIVDALGAGDTFVGAF 279
               :.|.:      |||..|..       |.|::|:..    ||..|.| ::|...|||:|...:
E. coli   211 EDVIARTHNAGVKEVVVKRGADSCLVSIAGEGLVDVPA----VKLPKEK-VIDTTAAGDSFSAGY 270

  Fly   280 IYALYIRERSVSVAVDFGNRMAS 302
            : |:.:...|...|...|:..||
E. coli   271 L-AVRLTGGSAEDAAKRGHLTAS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 67/347 (19%)
kdgKNP_417983.2 KdgK 4..301 CDD:238571 67/347 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43085
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.