DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and frlD

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_417833.1 Gene:frlD / 947886 ECOCYCID:G7726 Length:261 Species:Escherichia coli


Alignment Length:287 Identity:60/287 - (20%)
Similarity:103/287 - (35%) Gaps:78/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KTVLCIGTTTIDFVSTIKRFPEENSHQKVIGGYWIRGGKASNNCTVLANLGVKVEFLGMLSSWSV 79
            ||:..||...:|.      :|:.|..        ..||.|.|........|::...:..:.....
E. coli     2 KTLATIGDNCVDI------YPQLNKA--------FSGGNAVNVAVYCTRYGIQPGCITWVGDDDY 52

  Fly    80 FQVLVDDLKSRGIIIDNCPTCDQGAPFSSVILTK---ATKTRNIVYCNN----NFPYVSIDDFRK 137
            ...|..||...|:.|             |.:.||   ..:|:..::.|:    ::....:.|| .
E. coli    53 GTKLKQDLARMGVDI-------------SHVHTKHGVTAQTQVELHDNDRVFGDYTEGVMADF-A 103

  Fly   138 LNLNQYGWIHIRALYFDKSLPMVKDI----------EAYNANRKEKIVLSMEFDNNLDD-MW-PL 190
            |:...|.|:   |.|         ||          :|:........:.:.:|.:..|. :| .|
E. coli   104 LSEEDYAWL---AQY---------DIVHAAIWGHAEDAFPQLHAAGKLTAFDFSDKWDSPLWQTL 156

  Fly   191 MDYCDYAVFSKKLAQPNGWVSLEDACMQLDERLRMRWGLNLKR--PYVVVLWGDQGAGILDLNGN 253
            :.:.|:|..|               ..|.||.||::....:.|  ..|:|..|:.|:...| ...
E. coli   157 VPHLDFAFAS---------------APQEDETLRLKMKAIVARGAGTVIVTLGENGSIAWD-GAQ 205

  Fly   254 FTHVKPHKPKRIVDALGAGDTFVGAFI 280
            |....| :|..::|.:||||:|:..|:
E. coli   206 FWRQAP-EPVTVIDTMGAGDSFIAGFL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 59/286 (21%)
frlDNP_417833.1 PRK09813 2..261 CDD:182090 60/287 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003629
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43085
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.