DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and gsk

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_415010.1 Gene:gsk / 946584 ECOCYCID:EG11102 Length:434 Species:Escherichia coli


Alignment Length:65 Identity:14/65 - (21%)
Similarity:28/65 - (43%) Gaps:25/65 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 FTHVKPHK--PKRIVDALGAGDTFVGAFIYALYIRERSVSVAVDFGNRMASYKCTKNGYDHIANI 316
            ::|:.|:.  |::|::..||||..:.|.::.:                      |.|.| |.:|:
E. coli   337 YSHIAPYMGGPEKIMNTNGAGDGALAALLHDI----------------------TANSY-HRSNV 378

  Fly   317  316
            E. coli   379  378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 11/58 (19%)
gskNP_415010.1 PRK15074 1..434 CDD:185033 14/65 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43085
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.