DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and FLN2

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_177080.3 Gene:FLN2 / 843251 AraportID:AT1G69200 Length:614 Species:Arabidopsis thaliana


Alignment Length:373 Identity:76/373 - (20%)
Similarity:128/373 - (34%) Gaps:122/373 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HKLSWAVGKKTVLCIGTTTIDFVST---IKRFPEENSHQKVIGGYW-----IR--GGKASNNCTV 60
            |...|   ...|.|.|:....||.:   ..|..:...|:::....|     ||  ||.|......
plant   199 HTYGW---PPLVCCFGSAQHAFVPSGRPANRLLDYELHERMRDAKWAPEKYIRAPGGCAGGVAIA 260

  Fly    61 LANLGVKVEFLGMLSSWSVFQVL-----VDDLKSRGIIIDN-----CPT---------------- 99
            ||:||.||.|:|.|.:....|.:     |..:::|.:.||.     |.|                
plant   261 LASLGGKVAFMGKLGADDYGQAMLYYLNVCKVQTRSVKIDGKRVTACSTMKISKRGRLKSTCIKP 325

  Fly   100 CDQGAPFSSVILTKATKTRNIVYCNNNFPYVSIDDFRKLNL--------NQYGWIHIRALYFDKS 156
            |.:.:...|.|.....|...:.|    |...|:.|.:.::.        .|.|    ..:::|.:
plant   326 CAEDSLSKSEINVDVLKEAKMFY----FSTHSLLDKKMMSTTIQAIKISKQLG----NVIFYDLN 382

  Fly   157 LPMVKDIEAYNANRKEKIVLSMEFDNNLDDMWPLMDYCDYAVFSKKLAQPNGWVSLEDAC----- 216
            ||    :..::::.:.|        :.:.::|.|.|..:   .:|:        .||..|     
plant   383 LP----LPLWHSSEETK--------SFIQEVWNLADVIE---ITKQ--------ELEFLCGIEPT 424

  Fly   217 MQLD--------------ERLRMRWGLNLKRPYVVVLWGDQGAGIL-----DLNGNFTHVK--PH 260
            .:.|              |.:...|..|||     ||:...|...:     :.||..:.::  |.
plant   425 EEFDTENNDISKFVHYPPETVEQLWHENLK-----VLFVTNGTSKIHYYTKEHNGAVSGMEDVPI 484

  Fly   261 KP-KRIVDALGAGDTFVGAFIYALYIR----------ERSVSVAVDFG 297
            .| .|  |...:||..|...|..|.::          ||:...|::.|
plant   485 TPFTR--DMSASGDGIVAGLIRMLTVQPDLMNNKGYLERTARYAIECG 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 74/363 (20%)
FLN2NP_177080.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43085
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.