DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and AT1G66430

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_564875.2 Gene:AT1G66430 / 842961 AraportID:AT1G66430 Length:384 Species:Arabidopsis thaliana


Alignment Length:331 Identity:71/331 - (21%)
Similarity:115/331 - (34%) Gaps:92/331 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLCIGTTTIDFVST-----------IKRFPEENSHQKVIGGYWIRGGKASNNCTVLANLGVKVEF 70
            |:|.|...||||.|           .|:.|               ||..:|....:|.||....|
plant    66 VVCFGEMLIDFVPTTSGLSLADAPAFKKAP---------------GGAPANVAVGIARLGGSSAF 115

  Fly    71 LGMLSSWSVFQVLVDDLKSRGIIIDNCPTCDQGA--PFSSVILTKATKTRNIVYCNNNFPY---- 129
            :|.:.......:|.:.||...:..|.. ..|.||  ..:.|.||...:...:.|.|.:...    
plant   116 IGKVGEDEFGYMLANILKDNNVNNDGM-RFDPGARTALAFVTLTNEGEREFMFYRNPSADMLLEE 179

  Fly   130 --VSIDDFRKLNLNQYGWIHIRALYFDKSLPMVKD------IEAYNANRKEKIVLSMEFDNNLD- 185
              :..|..:|..:..||           |:.::.:      |.|..|.::..::||  :|.||. 
plant   180 SELDFDLIKKAKIFHYG-----------SISLITEPCKSAHISAAKAAKEAGVILS--YDPNLRL 231

  Fly   186 DMWPLMDYCDYAVFSKKLAQPNGWVSLEDACMQLDERLRMRWGLNLKRPY--------------- 235
            .:||..|.....:.|.       |.:.:...:..:|.:.:..|   :.||               
plant   232 PLWPSADNAREEILSI-------WETADIIKISEEEIVFLTKG---EDPYDDNVVRKLFHPKLKL 286

  Fly   236 VVVLWGDQGAGIL--DLNGNFTHVKPHKPKRIVDALGAGDTFVGAFI------YALYIRERSVSV 292
            ::|..|.:|....  |.:|....:|..    :||..||||.||...:      .:|...|..:..
plant   287 LLVTEGPEGCRYYTKDFSGRVHGLKVD----VVDTTGAGDAFVAGILSQLANDLSLLQDEERLRE 347

  Fly   293 AVDFGN 298
            |:.|.|
plant   348 ALMFAN 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 71/331 (21%)
AT1G66430NP_564875.2 PLN02323 55..384 CDD:215183 71/331 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43085
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.