DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and AT1G06030

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_172093.1 Gene:AT1G06030 / 837112 AraportID:AT1G06030 Length:329 Species:Arabidopsis thaliana


Alignment Length:342 Identity:75/342 - (21%)
Similarity:128/342 - (37%) Gaps:87/342 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KKTVLCIGTTTIDFVSTIKRFPEEN--SHQKVIGGYWIRGGKASNNCTVLANLGVKVEFLGMLSS 76
            |..|:..|...||||      |.|:  |..:..|.....||..:|....::.||.:..|:|.|..
plant     9 KGLVVSFGEMLIDFV------PTESGVSLSESSGFLKAPGGAPANVAIAVSRLGGRAAFVGKLGD 67

  Fly    77 WSVFQVLV-----DDLKSRGIIIDNCPTCDQGAPFSSVILT-KATKTRNIVYCNNNFP------- 128
            .....:|.     :|:..:||      ..|:||..:...:| ::...|..::..|  |       
plant    68 DEFGHMLAGILRKNDVDDQGI------NFDKGARTALAFVTLRSDGEREFMFYRN--PSADMLLR 124

  Fly   129 --YVSIDDFRKLNLNQYGWIHI-----RALYFDKSLPMVKDIEAYNANRKEKIVLSMEFDNNL-D 185
              .::::..|...:..||.|.:     |:.:. |::.:.|:..|.           :.:|.|| :
plant   125 PDELNLELIRSAKVFHYGSISLITEPCRSAHM-KAMEVAKEAGAL-----------LSYDPNLRE 177

  Fly   186 DMWPLMDYCDYAVFSKKLAQPNGW-----VSLEDACMQL--------DERLRMRWGLNLKRPYVV 237
            .:||..:.....:.|.       |     :.:.|..::.        ||.....|..|||  .::
plant   178 PLWPSPEEARKQIMSI-------WDKADIIKVSDVELEFLTGNKTIDDETAMSLWHPNLK--LLL 233

  Fly   238 VLWGDQGAGIL--DLNGNFT--HVKPHKPKRIVDALGAGDTFVGAFI------YALYIRERSVSV 292
            |..|:.|....  |.:|:..  ||.      .||..||||:||||.:      .::...|..:..
plant   234 VTLGENGCRYYTKDFHGSVETFHVD------AVDTTGAGDSFVGALLNQIVDDQSVLEEEERLRK 292

  Fly   293 AVDFGNRMASYKCTKNG 309
            .:.|.|...:...||.|
plant   293 VLRFANACGAITTTKKG 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 74/340 (22%)
AT1G06030NP_172093.1 PLN02323 1..329 CDD:215183 75/342 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43085
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.