DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and AT1G06020

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_172092.1 Gene:AT1G06020 / 837111 AraportID:AT1G06020 Length:345 Species:Arabidopsis thaliana


Alignment Length:336 Identity:73/336 - (21%)
Similarity:130/336 - (38%) Gaps:75/336 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KKTVLCIGTTTIDFVSTIKRFPEENSHQKVIGGYWIRGGKASNNCTVLANLGVKVEFLGMLSSWS 78
            |..::..|...||||.|:.......|.    |.....||..:|....::.||.:..|:|.|....
plant     8 KGLIVSFGEMLIDFVPTVSGVSLSESP----GFLKAPGGAPANVAIAVSRLGGRAAFVGKLGDDD 68

  Fly    79 VFQVLVDDLKSRGIIIDNCPTCDQGAPFSSVILT-KATKTRNIVYCNNNFP---------YVSID 133
            ...:|...|:..| :.|.....|:||..:...:| ::...|..::..|  |         .::::
plant    69 FGHMLAGILRKNG-VDDQGINFDEGARTALAFVTLRSDGEREFMFYRN--PSADMLLRPDELNLE 130

  Fly   134 DFRKLNLNQYGWIHI-----RALYFDKSLPMVKDIEAYNANRKEKIVLSMEFDNNL-DDMWPLMD 192
            ..|...:..||.|.:     |:.:. |::.:.|:..|.           :.:|.|| :.:||..:
plant   131 LIRSAKVFHYGSISLITEPCRSAHM-KAMEVAKEAGAL-----------LSYDPNLREPLWPSPE 183

  Fly   193 YCDYAVFSKKLAQPNGW-----VSLEDACMQ-------LDERLRMR-WGLNLKRPYVVVLWGDQG 244
            .....:.|.       |     :.:.|..::       :|::..|. |..|||  .::|..|::|
plant   184 EARTQIMSI-------WDKADIIKVSDVELEFLTENKTMDDKTAMSLWHPNLK--LLLVTLGEKG 239

  Fly   245 AGIL--DLNGNFT--HVKPHKPKRIVDALGAGDTFVGAFIYALYIRERSV-------SVAVDFGN 298
            ....  ..:|:..  ||.      .||..||||:||||.:..: :.::||       ...:.|.|
plant   240 CTYFTKKFHGSVETFHVD------AVDTTGAGDSFVGALLQQI-VDDQSVLEDEARLRKVLRFAN 297

  Fly   299 RMASYKCTKNG 309
            ...:...||.|
plant   298 ACGAITTTKKG 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 72/334 (22%)
AT1G06020NP_172092.1 PLN02323 1..328 CDD:215183 73/336 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43085
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.