powered by:
Protein Alignment CG7551 and Mik
DIOPT Version :9
Sequence 1: | NP_648466.1 |
Gene: | CG7551 / 39280 |
FlyBaseID: | FBgn0036161 |
Length: | 322 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_200681.1 |
Gene: | Mik / 835987 |
AraportID: | AT5G58730 |
Length: | 353 |
Species: | Arabidopsis thaliana |
Alignment Length: | 67 |
Identity: | 25/67 - (37%) |
Similarity: | 33/67 - (49%) |
Gaps: | 3/67 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 236 VVVLWGDQGAGILDLNGNFTHVKPHKPKRIVDALGAGDTFVGAFIYALYIRERSVSVAVDFGNRM 300
|||..|::|..|...:...| |.|...|: ||..||||:|:|..|..| :...:|..|...||..
plant 215 VVVTNGEKGCRIYHKDDEMT-VPPFLAKQ-VDPTGAGDSFLGGLIVGL-VEGLTVPDAALLGNLF 276
Fly 301 AS 302
.|
plant 277 GS 278
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR43085 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.