DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and AT5G43910

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_974877.1 Gene:AT5G43910 / 834413 AraportID:AT5G43910 Length:365 Species:Arabidopsis thaliana


Alignment Length:377 Identity:89/377 - (23%)
Similarity:142/377 - (37%) Gaps:105/377 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKKTVLCIGTTTIDFVSTIKRFPEENSHQKVIG-GYWIR-GGKASNNCTVLANLGVKVEFLGMLS 75
            |:..||..|...:|::.|:..||..:  ||:.| .:.:: ||...|..|.:|.||:....|..::
plant    11 GQPIVLGCGQLCLDYLVTVASFPIPD--QKIRGTSFKVQGGGNTGNALTCVARLGLPCRILAKVA 73

  Fly    76 SWSVFQVLVDDLKSRGIIIDNCPTCDQGAP-FSSVILTKATKTRNIVYCNNNFPYVSIDDFRKLN 139
            ..|..:.:|::|:|.|:....|.:...||. |:.||:...|.||..:|.....|.:..|....|.
plant    74 DDSHGRYMVEELESSGVDTSFCMSAKDGASHFNYVIVDNQTNTRTCIYTPGYPPLLPDDLTESLL 138

  Fly   140 LNQYGWIHIRALYFD----------------KSLPMVKDIEAYNANRKEKIVLSMEFDNNLDDMW 188
            |:...  .:|.||.:                |::|::     .||.:|.         ..||:  
plant   139 LDVLD--GVRVLYVNGRSREAELLLAQKAHSKNIPIL-----INAEKKR---------TGLDE-- 185

  Fly   189 PLMDYCDYAVFSKKLAQPNGWV---SLEDACMQLDERLRMRWGLNLKRPYVVVLWGDQGAGILD- 249
             |:|..|||:.|...  |..|.   |...|.:.:..||.       |..:|::..|:.|..:|: 
plant   186 -LIDLADYAICSTNF--PQEWTGAPSSPSALLSMLIRLP-------KLKFVIMTLGEHGCVMLER 240

  Fly   250 -----------------------------------------LNGNFTH----VKPHK--PKRIVD 267
                                                     |.||.|.    |...|  ...::|
plant   241 CSSEVSGSEEETDIDELHESLKQSTDFTSVLPVCNSSLVTRLTGNVTGRLVIVTAEKIPSSELID 305

  Fly   268 ALGAGDTFVGAFIYALYIRERSVSVAVDFGNRMASYKCTKNGYDHIANILLP 319
            ..||||.|.||.:|.| ....::...:.|.:|:|:..|...|    |...||
plant   306 TTGAGDAFTGALLYGL-CTGMALEEMLTFASRVAACCCRGLG----ARTSLP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 85/364 (23%)
AT5G43910NP_974877.1 ribokinase_group_B 14..353 CDD:238920 88/374 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3997
eggNOG 1 0.900 - - E1_KOG2947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1008502at2759
OrthoFinder 1 1.000 - - FOG0003629
OrthoInspector 1 1.000 - - otm2759
orthoMCL 1 0.900 - - OOG6_104955
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.